PDB entry 3eom

View 3eom on RCSB PDB site
Description: 2.4 A crystal structure of native glutaryl-coa dehydrogenase from Burkholderia pseudomallei
Class: oxidoreductase
Keywords: burkholderia, pseudomallei, glutaryl-coa, dehydrogenase, seattle structural genomics center for infectious disease, ssgcid, oxidoreductase
Deposited on 2008-09-28, released 2008-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eoma1, d3eoma2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eomb1, d3eomb2
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eomc1, d3eomc2
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eomd1, d3eomd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eomA (A:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eomA (A:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwaklde
    dgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpf
    tclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlgl
    qgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngsdefgvarhlvnle
    vvntyegthdihalilgraqtgiqaff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eomB (B:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eomB (B:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepnhgsmvtrarkvpggyslsgskmwitnspiadvfvvwakldd
    eirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftcln
    sarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvl
    rlgrmkdegtaaveitsimkrnscgkaldiarlardmlgsdefgvarhlvnlevvntyeg
    thdihalilgraqtgiqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3eomC (C:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eomC (C:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfgltegsmvtrarkvpggyslsgskmwitnspiadvfvvwakldedg
    rdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftc
    lnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqg
    vlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnlev
    vntyedihalilgraqtgiqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3eomD (D:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eomD (D:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfgltepsmvtrarkvpggyslsgskmwitnspiadvfvvwaklddgr
    deirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftcl
    nsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgv
    lrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggndefgvarhlvnlevvnty
    egthdihalilgraqtgiqaf