PDB entry 3eo9

View 3eo9 on RCSB PDB site
Description: Crystal structure the Fab fragment of Efalizumab
Class: immune system
Keywords: Efalizumab, Fab, antibody, IMMUNE SYSTEM
Deposited on 2008-09-26, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Efalizumab Fab fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO9 (0-218)
  • Chain 'L':
    Compound: Efalizumab Fab fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO9 (0-End)
    Domains in SCOPe 2.07: d3eo9l1, d3eo9l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3eo9L (L:)
    diqmtqspsslsasvgdrvtitcrasktiskylawyqqkpgkapklliysgstlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqhneypltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eo9L (L:)
    diqmtqspsslsasvgdrvtitcrasktiskylawyqqkpgkapklliysgstlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqhneypltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge