PDB entry 3eo0

View 3eo0 on RCSB PDB site
Description: Structure of the Transforming Growth Factor-Beta Neutralizing Antibody GC-1008
Class: immune system
Keywords: Cytokine neutralizing antibody, FAB fragment, IMMUNE SYSTEM
Deposited on 2008-09-26, released 2008-12-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GC-1008 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO0 (0-214)
    Domains in SCOPe 2.04: d3eo0a1, d3eo0a2
  • Chain 'B':
    Compound: GC-1008 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO0 (0-End)
  • Chain 'C':
    Compound: GC-1008 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO0 (0-214)
    Domains in SCOPe 2.04: d3eo0c1, d3eo0c2
  • Chain 'D':
    Compound: GC-1008 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO0 (0-End)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eo0A (A:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eo0C (C:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    No sequence available.