PDB entry 3end

View 3end on RCSB PDB site
Description: Crystal structure of the L protein of Rhodobacter sphaeroides light-independent protochlorophyllide reductase (BchL) with MgADP bound: a homologue of the nitrogenase Fe protein
Class: oxidoreductase
Keywords: BchL, protochlorophyllide, Electron donor, DPOR, Fe protein, nitrogenase, mixed aplha-beta domain, MgADP, 4Fe-4S, ATP-binding, Bacteriochlorophyll biosynthesis, Chlorophyll biosynthesis, Iron, Iron-sulfur, Metal-binding, Nucleotide-binding, Oxidoreductase, Photosynthesis
Deposited on 2008-09-25, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.174
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: bchL, RHOS4_18930, RSP_0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3enda_
  • Chain 'B':
    Compound: Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: bchL, RHOS4_18930, RSP_0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3endb_
  • Heterogens: ADP, MG, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3endA (A:)
    mhhhhhhhgmgspkdltiptgadgegsvqvhldeadkitgakvfavygkggigksttssn
    lsaafsilgkrvlqigcdpkhdstftltgslvptvidvlkdvdfhpeelrpedfvfegfn
    gvmcveaggppagtgcggyvvgqtvkllkqhhllddtdvvifdvlgdvvcggfaaplqha
    dqavvvtandfdsiyamnriiaavqaksknykvrlagcvanrsratdevdrfcketnfrr
    lahmpdldairrsrlkkktlfemdedqdvlaaraeyirlaeslwrgldpidphslpdrdi
    fellgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3endA (A:)
    gakvfavygkggigksttssnlsaafsilgkrvlqigcdpkhdstftltgslvptvidvl
    kdvdfhpeelrpedfvfegfngvmcveaggppagtgcggyvvgqtvkllkqhhllddtdv
    vifdvlgdvvcggfaaplqhadqavvvtandfdsiyamnriiaavqaksknykvrlagcv
    anrsratdevdrfcketnfrrlahmpdldairrsrlkkktlfemdedqdvlaaraeyirl
    aeslwrgldpidphslpdrdifellgfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3endB (B:)
    mhhhhhhhgmgspkdltiptgadgegsvqvhldeadkitgakvfavygkggigksttssn
    lsaafsilgkrvlqigcdpkhdstftltgslvptvidvlkdvdfhpeelrpedfvfegfn
    gvmcveaggppagtgcggyvvgqtvkllkqhhllddtdvvifdvlgdvvcggfaaplqha
    dqavvvtandfdsiyamnriiaavqaksknykvrlagcvanrsratdevdrfcketnfrr
    lahmpdldairrsrlkkktlfemdedqdvlaaraeyirlaeslwrgldpidphslpdrdi
    fellgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3endB (B:)
    gakvfavygkggigksttssnlsaafsilgkrvlqigcdpkhdstftltgslvptvidvl
    kdvdfhpeelrpedfvfegfngvmcveaggppagtgcggyvvgqtvkllkqhhllddtdv
    vifdvlgdvvcggfaaplqhadqavvvtandfdsiyamnriiaavqaksknykvrlagcv
    anrsratdevdrfcketnfrrlahmpdldairrsrlkkktlfemdedqdvlaaraeyirl
    aeslwrgldpidphslpdrdifellgfd