PDB entry 3enb

View 3enb on RCSB PDB site
Description: Crystal Structure of PRP8 core domain IV
Class: RNA binding protein
Keywords: PRP8 domain IV, beta finger, RNase H, spliceosome, U5-220K, Disease mutation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Retinitis pigmentosa, RNA-binding, Sensory transduction, Vision, RNA BINDING PROTEIN
Deposited on 2008-09-25, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-processing-splicing factor 8
    Species: Homo sapiens [TaxId:9606]
    Gene: PRPF8, PRPC8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3enba1
  • Chain 'B':
    Compound: Pre-mRNA-processing-splicing factor 8
    Species: Homo sapiens [TaxId:9606]
    Gene: PRPF8, PRPC8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3enbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3enbA (A:)
    gelfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwa
    gqkrlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgse
    lqlpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnnd
    rakvilkpdkttitephhiwptltdeewikvevqlkdlilad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3enbA (A:)
    lfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwagq
    krlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselq
    lpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndra
    kvilkpdkttitephhiwptltdeewikvevqlkdlila
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3enbB (B:)
    gelfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwa
    gqkrlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgse
    lqlpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnnd
    rakvilkpdkttitephhiwptltdeewikvevqlkdlilad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3enbB (B:)
    nqiiwfvddtnvyrvtpingaififnprtgqlflkiihtsvwagqkrlgqlakwktaeev
    aalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselqlpfqaclkvekfgdl
    ilkatepqmvlfnlyddwlktissytafsrlililralhvnndrakvilkpdkttiteph
    hiwptltdeewikvevqlkdlil