PDB entry 3ekr

View 3ekr on RCSB PDB site
Description: Dihydroxylphenyl amides as inhibitors of the Hsp90 molecular chaperone
Class: chaperone
Keywords: HSP90 inhibitors, Alternative splicing, ATP-binding, Chaperone, Cytoplasm, Nucleotide-binding, Phosphoprotein, Stress response
Deposited on 2008-09-19, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (Start-217)
      • expression tag (218)
    Domains in SCOPe 2.07: d3ekra1, d3ekra2
  • Chain 'B':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (1-217)
      • expression tag (218)
    Domains in SCOPe 2.07: d3ekrb1, d3ekrb2
  • Heterogens: PY9, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ekrA (A:)
    mdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdp
    skldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagad
    ismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvi
    lhlkedqteyleerrikeivkkhsqfigypitlfvekelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ekrA (A:)
    qpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpsk
    ldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadis
    migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh
    lkedqteyleerrikeivkkhsqfigypitlfvekel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ekrB (B:)
    mdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdp
    skldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagad
    ismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvi
    lhlkedqteyleerrikeivkkhsqfigypitlfvekelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ekrB (B:)
    dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
    kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
    smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
    hlkedqteyleerrikeivkkhsqfigypitlfvekel