PDB entry 3ejj

View 3ejj on RCSB PDB site
Description: Structure of M-CSF bound to the first three domains of FMS
Class: cytokine/signaling protein
Keywords: growth factor-receptor complex, receptor tyrosine kinase, cytokine, 4-helix bundle, ATP-binding, Glycoprotein, Immunoglobulin domain, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Proto-oncogene, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, CYTOKINE-SIGNALING PROTEIN COMPLEX
Deposited on 2008-09-18, released 2008-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.238
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colony stimulating factor-1
    Species: Mus musculus [TaxId:10090]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3U395 (3-147)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3ejja1, d3ejja2
  • Chain 'B':
    Compound: Colony stimulating factor-1
    Species: Mus musculus [TaxId:10090]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ejjb_
  • Chain 'X':
    Compound: Macrophage colony-stimulating factor 1 receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Csf1r, Csfmr, Fms
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ejjA (A:)
    adpsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
    idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf
    fnetknllekdwniftkncnnsfakcsshhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejjA (A:)
    adpsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
    idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf
    fnetknllekdwniftkncnnsfakcss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ejjB (B:)
    adpsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
    idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf
    fnetknllekdwniftkncnnsfakcsshhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejjB (B:)
    sehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdiide
    tmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknffne
    tknllekdwniftkncnnsfakcss
    

  • Chain 'X':
    No sequence available.