PDB entry 3ej5

View 3ej5 on RCSB PDB site
Description: complex of Ricin A chain and pyrimidine-based inhibitor
Class: hydrolase
Keywords: protein inhibitor complex, Glycoprotein, Hydrolase, Lectin, Nucleotide-binding, Plant defense, Protein synthesis inhibitor, Toxin
Deposited on 2008-09-17, released 2009-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ricin a chain
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02879 (0-256)
      • conflict (161)
    Domains in SCOPe 2.08: d3ej5x_
  • Heterogens: EJ5, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ej5X (X:)
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlaisfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcap