PDB entry 3eix

View 3eix on RCSB PDB site
Description: Crystal structure of selenomethionine labelled Staphylococcus aureus lipoprotein, HtsA
Class: transport protein
Keywords: siderophore, lipoprotein, heme, haem, TRANSPORT PROTEIN
Deposited on 2008-09-17, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HtsA protein
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: htsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99S89 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d3eixa1, d3eixa2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eixA (A:)
    gshmastisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpv
    rekigdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdyk
    qninsfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpn
    ysyvgqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkds
    aefkklqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskkeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eixA (A:)
    astisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvreki
    gdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqnin
    sfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyv
    gqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefk
    klqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskke