PDB entry 3ehx

View 3ehx on RCSB PDB site
Description: Crystal structure of the catalytic domain of human MMP12 complexed with the inhibitor (R)-2-(biphenyl-4-ylsulfonamido)-4-methylpentanoic acid
Class: hydrolase
Keywords: MATRIX METALLOPROTEINASE, MMP12, ELASTASE, COMPLEX (ELASTASE/INHIBITOR), METALLO ELASTASE,, Calcium, Extracellular matrix, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2008-09-15, released 2009-05-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-157)
      • engineered (65)
    Domains in SCOPe 2.06: d3ehxa_
  • Heterogens: ZN, CA, BDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ehxA (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg