PDB entry 3eh4

View 3eh4 on RCSB PDB site
Description: Structure of the reduced form of cytochrome ba3 oxidase from Thermus thermophilus
Class: oxidoreductase
Keywords: CYTOCHROME BA3 OXIDASE, HEME, INTEGRAL MEMBRANE PROTEIN, COPPER, ELECTRON TRANSPORT, HYDROGEN ION TRANSPORT, ION TRANSPORT, IRON, METAL-BINDING, OXIDOREDUCTASE, RESPIRATORY CHAIN, TRANSMEMBRANE, TRANSPORT, FORMYLATION, Cell membrane, Membrane
Deposited on 2008-09-11, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-617)
      • engineered (313)
    Domains in SCOPe 2.07: d3eh4a_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ80 (0-165)
      • engineered (1)
    Domains in SCOPe 2.07: d3eh4b1, d3eh4b2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eh4c_
  • Heterogens: CU1, HEM, HAS, CUA, BNG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eh4A (A:)
    seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllmhhhhhhavr
    aseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqs
    yyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpl
    laneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvty
    mavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpay
    aiiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlf
    vavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggi
    vnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglav
    vwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllf
    iyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygp
    tlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eh4A (A:)
    seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
    yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
    aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
    avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
    iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
    avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
    nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
    wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
    yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
    lvqlfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eh4B (B:)
    dqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eh4C (C:)
    eekpkgalavilvltltilvfwlgvyavffarg