PDB entry 3egz

View 3egz on RCSB PDB site
Description: Crystal structure of an in vitro evolved tetracycline aptamer and artificial riboswitch
Class: rna
Keywords: tetracycline, aptamer, riboswitch, antibiotic, RNA
Deposited on 2008-09-11, released 2008-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.05: d3egza_
  • Chain 'B':
    Compound: Tetracycline aptamer and artificial riboswitch
    Species: synthetic, synthetic
  • Heterogens: MG, CTC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3egzA (A:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records): (download) 
    >3egzA (A:)
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiak

  • Chain 'B':
    No sequence available.