PDB entry 3egt

View 3egt on RCSB PDB site
Description: T. Brucei Farnesyl Diphosphate Synthase Complexed with Bisphosphonate BPH-722
Class: transferase
Keywords: protein-bisphosphonate complex, isoprene biosynthesis, transferase
Deposited on 2008-09-11, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egta_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egtb_
  • Heterogens: MG, 722, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3egtA (A:)
    mgsshhhhhhssglvprgshmasmgsshhhhhhssglvprgshmasmpmqmfmqvydeiq
    mflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaesllslspnnngeedd
    garrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcaindgl
    llkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptt
    tdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgeyfqvq
    ddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekvatvr
    rlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egtA (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsldgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqca
    indglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdv
    sqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmge
    yfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsek
    vatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3egtB (B:)
    mgsshhhhhhssglvprgshmasmgsshhhhhhssglvprgshmasmpmqmfmqvydeiq
    mflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaesllslspnnngeedd
    garrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcaindgl
    llkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptt
    tdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgeyfqvq
    ddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekvatvr
    rlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egtB (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqc
    aindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpd
    vsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmg
    eyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdse
    kvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk