PDB entry 3egp

View 3egp on RCSB PDB site
Description: Crystal structure analysis of dengue-1 envelope protein domain III
Class: viral protein
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, VIRAL PROTEIN
Deposited on 2008-09-11, released 2008-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.254
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Dengue virus 1 [TaxId:11053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3egpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3egpA (A:)
    mtlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrl
    itanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egpA (A:)
    msyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanp
    ivtdkekpvnieaeppfgesyivvgagekalklswfkkgssi