PDB entry 3egn

View 3egn on RCSB PDB site
Description: C-terminal RNA Recognition Motif of the U11/U12 65K Protein
Class: splicing
Keywords: RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, U11/U12 di-snRNP, U1A protein, U2B protein, minor spliceosomal protein, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, SPLICING
Deposited on 2008-09-11, released 2009-06-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 40
    Species: Homo sapiens [TaxId:9606]
    Gene: U11/U12 snRNP 65K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3egna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3egnA (A:)
    gplgsdsdempsecisrrelekgrisreemetlsvfrsyepgepncriyvknlakhvqek
    dlkyifgryvdfssetqrimfdirlmkegrmkgqafiglpnekaaakalkeangyvlfgk
    pmvvqfarsarpkqdpkegkrkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egnA (A:)
    ecisrrelekgrisreemetlsvfrsyepgepncriyvknlakhvqekdlkyifgryvdf
    ssetqrimfdirlmkegrmkgqafiglpnekaaakalkeangyvlfgkpmvvqfarsarp