PDB entry 3egm

View 3egm on RCSB PDB site
Description: Structural basis of iron transport gating in Helicobacter pylori ferritin
Class: oxidoreductase
Keywords: iron storage, Iron, Metal-binding, Oxidoreductase
Deposited on 2008-09-11, released 2009-07-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.03: d3egma_
  • Chain 'B':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.03: d3egmb_
  • Chain 'C':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.03: d3egmc_
  • Chain 'D':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.03: d3egmd_
  • Chain 'E':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.03: d3egme_
  • Chain 'F':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.03: d3egmf_
  • Heterogens: FE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3egmA (A:)
    mgssphhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egmA (A:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3egmB (B:)
    mgssphhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egmB (B:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3egmC (C:)
    mgssphhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egmC (C:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3egmD (D:)
    mgssphhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egmD (D:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3egmE (E:)
    mgssphhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egmE (E:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3egmF (F:)
    mgssphhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egmF (F:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk