PDB entry 3efw

View 3efw on RCSB PDB site
Description: Structure of AuroraA with pyridyl-pyrimidine urea inhibitor
Class: Transferase/Inhibitor
Keywords: AuroraA, STK6_human, ATP-binding, Cell cycle, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase-Inhibitor complex
Deposited on 2008-09-10, released 2008-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.26
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3efwa_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3efwb_
  • Heterogens: AK8, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3efwA (A:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efwA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfldylppemiekvdlwslgvlcyeflvgkpp
    feantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitanss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3efwB (B:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efwB (B:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfldylppemieekvdlwslgvlcyeflvgkp
    pfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitans
    sk