PDB entry 3efv

View 3efv on RCSB PDB site
Description: Crystal Structure of a Putative Succinate-Semialdehyde Dehydrogenase from Salmonella typhimurium LT2 with bound NAD
Class: oxidoreductase
Keywords: putative succinate-semialdehyde dehydrogenase, Center for Structural Genomics of Infectious Diseases, Oxidoreductase, CSGID
Deposited on 2008-09-10, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative succinate-semialdehyde dehydrogenase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yneI, STM1524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3efva_
  • Chain 'B':
    Compound: Putative succinate-semialdehyde dehydrogenase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yneI, STM1524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3efvb_
  • Chain 'C':
    Compound: Putative succinate-semialdehyde dehydrogenase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yneI, STM1524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3efvc_
  • Chain 'D':
    Compound: Putative succinate-semialdehyde dehydrogenase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yneI, STM1524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3efvd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3efvA (A:)
    mtmmtatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdi
    gqalrahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqa
    vieyrplgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeag
    tpagvygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdp
    fivlndadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdp
    lveendlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmt
    afrqelfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfin
    gysasdarvafggvkksgfgrelshfglhefcnvqtvwknrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efvA (A:)
    mtatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqa
    lrahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqavie
    yrplgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpa
    gvygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdpfiv
    lndadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdplve
    endlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmtafr
    qelfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfingys
    asdarvafggvkksgfgrelshfglhefcnvqtvwknrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3efvB (B:)
    mtmmtatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdi
    gqalrahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqa
    vieyrplgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeag
    tpagvygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdp
    fivlndadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdp
    lveendlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmt
    afrqelfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfin
    gysasdarvafggvkksgfgrelshfglhefcnvqtvwknrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efvB (B:)
    tatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqal
    rahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqaviey
    rplgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpag
    vygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdpfivl
    ndadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdplvee
    ndlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmtafrq
    elfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfingysa
    sdarvafggvkksgfgrelshfglhefcnvqtvwknrv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3efvC (C:)
    mtmmtatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdi
    gqalrahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqa
    vieyrplgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeag
    tpagvygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdp
    fivlndadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdp
    lveendlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmt
    afrqelfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfin
    gysasdarvafggvkksgfgrelshfglhefcnvqtvwknrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efvC (C:)
    atqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqalr
    ahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqavieyr
    plgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpagv
    ygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdpfivln
    dadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdplveen
    dlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmtafrqe
    lfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfingysas
    darvafggvkksgfgrelshfglhefcnvqtvwknrv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3efvD (D:)
    mtmmtatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdi
    gqalrahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqa
    vieyrplgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeag
    tpagvygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdp
    fivlndadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdp
    lveendlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmt
    afrqelfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfin
    gysasdarvafggvkksgfgrelshfglhefcnvqtvwknrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efvD (D:)
    atqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqalr
    ahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqavieyr
    plgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpagv
    ygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdpfivln
    dadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdplveen
    dlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmtafrqe
    lfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfingysas
    darvafggvkksgfgrelshfglhefcnvqtvwknrv