PDB entry 3efq

View 3efq on RCSB PDB site
Description: T. Brucei Farnesyl Diphosphate Synthase Complexed with Bisphosphonate BPH-714
Class: transferase
Keywords: protein-bisphosphonate complex, isoprene biosynthesis, transferase
Deposited on 2008-09-09, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.242
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3efqa_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3efqb_
  • Heterogens: MG, 714, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3efqA (A:)
    mgsshhhhhhssglvprgshmasmpmqmfmqvydeiqmflleelelkfdmdpnrvrylrk
    mmdttclggkynrgltvidvaesllslspnnngeeddgarrkrvlhdacvcgwmieflqa
    hylveddimdnsvtrrgkpcwyrhpdvtvqcaindglllkswthmmamhffadrpflqdl
    lcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptttdfaeftlsnykrivkyktayyt
    yllplvmglivsealptvdmgvteelamlmgeyfqvqddvmdcftpperlgkvgtdiqda
    kcswlavtflakassaqvaefkanygsgdsekvatvrrlyeeadlqgdyvayeaavaeqv
    kelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efqA (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsldgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqca
    indglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdv
    sqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmge
    yfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsek
    vatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3efqB (B:)
    mgsshhhhhhssglvprgshmasmpmqmfmqvydeiqmflleelelkfdmdpnrvrylrk
    mmdttclggkynrgltvidvaesllslspnnngeeddgarrkrvlhdacvcgwmieflqa
    hylveddimdnsvtrrgkpcwyrhpdvtvqcaindglllkswthmmamhffadrpflqdl
    lcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptttdfaeftlsnykrivkyktayyt
    yllplvmglivsealptvdmgvteelamlmgeyfqvqddvmdcftpperlgkvgtdiqda
    kcswlavtflakassaqvaefkanygsgdsekvatvrrlyeeadlqgdyvayeaavaeqv
    kelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efqB (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqc
    aindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpd
    vsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmg
    eyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdse
    kvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk