PDB entry 3eez

View 3eez on RCSB PDB site
Description: Crystal structure of a putative mandelate racemase/muconate lactonizing enzyme from Silicibacter pomeroyi
Class: isomerase
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2008-09-07, released 2008-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPO1594
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LT20 (3-369)
      • expression tag (2)
      • engineered (186)
      • engineered (285)
      • expression tag (370)
    Domains in SCOPe 2.06: d3eeza1, d3eeza2, d3eeza3, d3eeza4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eezA (A:)
    mslkitritvyqvdlplehpywlsggrlkfelldatlvkletdagitgwgegtpwghtyv
    pahgpgiragietmapfvlgldprrlldveramdialpghlyakspidmacwdiagqaag
    lpiadlmgggsrtprpiassvgaksveetravidryrqrgyvahsvkiggdverdiarir
    dvedirepgeivlydvnrgwtrqqalrvmratedlhvmfeqpgetlddiaairplhsapv
    svdeclvtlqdaarvardglaevfgiklnrvggltraarmrdialthgidmfvmatggsv
    ladaealhlaatipdhachavwacqdmltvdiaggrgprnidghlhlpetpglgvhpded
    algdpvavyseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eezA (A:)
    lkitritvyqvdlplehpywkfelldatlvkletdagitgwgegtpwghtyvpahgpgir
    agietmapfvlgldprrlldveramdialpghlyakspidmacwdiagqaaglpiadlmg
    ggsrtprpiassvgaksveetravidryrqrgyvahsvkiggdverdiarirdvedirep
    geivlydvnrgwtrqqalrvmratedlhvmfeqpgetlddiaairplhsapvsvdeclvt
    lqdaarvardglaevfgiklnrvggltraarmrdialthgidmfvmatggsvladaealh
    laatipdhachavwacqdmltvdiaggrgprnidghlhlpetpglgvhpdedalgdpvav
    yse