PDB entry 3eer

View 3eer on RCSB PDB site
Description: High resolution structure of putative organic hydroperoxide resistance protein from Vibrio cholerae O1 biovar eltor str. N16961
Class: oxidoreductase
Keywords: CSGID, organic hydroperoxide resistance protein, ORHC, Structural Genomics, Center for Structural Genomics of Infectious Diseases, OXIDOREDUCTASE
Deposited on 2008-09-05, released 2008-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.141
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Organic hydroperoxide resistance protein, putative
  Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
  Gene: VC_A1006
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KKU4 (Start-147)
  Domains in SCOPe 2.08: d3eera_
• Heterogens: ACT, ZN, IMD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3eerA (A:)
  snamrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavg
  yaacfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlv
  tvahqvcpysnavrgnidvqvsvnglal
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3eerA (A:)
  mstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaacfsna
  ilhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvahqvcp
  ysnavrgnidvqvsvnglal