PDB entry 3eer

View 3eer on RCSB PDB site
Description: High resolution structure of putative organic hydroperoxide resistance protein from Vibrio cholerae O1 biovar eltor str. N16961
Class: oxidoreductase
Keywords: CSGID, organic hydroperoxide resistance protein, ORHC, Structural Genomics, Center for Structural Genomics of Infectious Diseases, OXIDOREDUCTASE
Deposited on 2008-09-05, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.141
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Organic hydroperoxide resistance protein, putative
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_A1006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eera_
  • Heterogens: ACT, ZN, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eerA (A:)
    snamrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavg
    yaacfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlv
    tvahqvcpysnavrgnidvqvsvnglal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eerA (A:)
    mstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaacfsna
    ilhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvahqvcp
    ysnavrgnidvqvsvnglal