PDB entry 3ee2

View 3ee2 on RCSB PDB site
Description: Structure of human prostaglandin D-synthase (hGSTS1-1) in complex with nocodazole
Class: isomerase
Keywords: H-PGDS, prostanoid production, inflamation, nocodazole, glutathione transferase sigma, Fatty acid biosynthesis, Isomerase, Lipid synthesis, Prostaglandin biosynthesis
Deposited on 2008-09-04, released 2008-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PGDS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760 (Start-198)
      • see remark 999 (186)
    Domains in SCOPe 2.07: d3ee2a1, d3ee2a2
  • Chain 'B':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PGDS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760 (Start-198)
      • see remark 999 (186)
    Domains in SCOPe 2.07: d3ee2b1, d3ee2b2
  • Heterogens: GSH, NZO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ee2A (A:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipaianwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ee2A (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipaianwikrrpqtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ee2B (B:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipaianwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ee2B (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipaianwikrrpqtkl