PDB entry 3edi

View 3edi on RCSB PDB site
Description: Crystal structure of tolloid-like protease 1 (TLL-1) protease domain
Class: hydrolase
Keywords: disordered cysteine-rich loop, Alternative splicing, Calcium, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2008-09-03, released 2008-09-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.155
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tolloid-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TLL1, TLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3edia_
  • Heterogens: ACE, ZN, SO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ediA (A:)
    aatsrteriwpggvipyviggnftgsqramfkqamrhwekhtcvtfiersdeesyivfty
    rpcgccsyvgrrgngpqaisigkncdkfgivvhelghvigfwhehtrpdrdnhvtiiren
    iqpgqeynflkmepgevnslgerydfdsimhyarntfsrgmfldtilpsrddngirpaig
    qrtrlskgdiaqarklyrcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ediA (A:)
    aatsrteriwpggvipyviggnftgsqramfkqamrhwekhtcvtfiersdeesyivfty
    rcsyvgrrgngpqaisincdkfgivvhelghvigfwhehtrpdrdnhvtiireniqpgqe
    ynflkmepgevnslgerydfdsimhyarntfsrgmfldtilpsrddngirpaigqrtrls
    kgdiaqarklyrcpa