PDB entry 3edg

View 3edg on RCSB PDB site
Description: Crystal structure of bone morphogenetic protein 1 protease domain
Class: hydrolase
Keywords: vicinal disulfide, Alternative splicing, Calcium, Chondrogenesis, Cleavage on pair of basic residues, Cytokine, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Growth factor, Hydrolase, Metal-binding, Metalloprotease, Osteogenesis, Polymorphism, Protease, Zinc, Zymogen
Deposited on 2008-09-03, released 2008-09-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: 0.146
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP1, PCOLC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3edga_
  • Heterogens: ACE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3edgA (A:)
    maatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivft
    yrpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivre
    niqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppi
    gqrtrlskgdiaqarklykcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edgA (A:)
    aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
    rpcgsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivreniq
    pgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyekppigqrtrls
    kgdiaqarklykcpa