PDB entry 3ede

View 3ede on RCSB PDB site
Description: Structural base for cyclodextrin hydrolysis
Class: hydrolase
Keywords: contact mutant, Hydrolase, Glycosidase
Deposited on 2008-09-03, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrinase
    Species: Flavobacterium sp. 92 [TaxId:197856]
    Gene: cdase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KKG0
      • engineered (48)
    Domains in SCOPe 2.07: d3edea1, d3edea2, d3edea3
  • Chain 'B':
    Compound: cyclomaltodextrinase
    Species: Flavobacterium sp. 92 [TaxId:197856]
    Gene: cdase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KKG0
      • engineered (48)
    Domains in SCOPe 2.07: d3edeb1, d3edeb2, d3edeb3
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3edeA (A:)
    aaptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edeA (A:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3edeB (B:)
    aaptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edeB (B:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglp