PDB entry 3eco

View 3eco on RCSB PDB site
Description: Crystal structure of MepR, a transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA
Class: transcription
Keywords: mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, Transcription, Transcription regulation
Deposited on 2008-09-01, released 2009-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.242
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: SAV0333
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ecoa_
  • Chain 'B':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: SAV0333
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ecob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ecoA (A:)
    meftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ecoA (A:)
    ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
    tvsnllrnlerkkliyryvdaqrrkniglttsgiklveaftsifdemeqtlvsqlseeen
    eqmkanltkmlsslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ecoB (B:)
    meftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ecoB (B:)
    tysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgpt
    vsnllrnlerkkliyryvkniglttsgiklveaftsifdemeqtlvsqlseeeneqmkan
    ltkmlsslq