PDB entry 3ec6

View 3ec6 on RCSB PDB site
Description: Crystal structure of the General Stress Protein 26 from Bacillus anthracis str. Sterne
Class: Structural Genomics, Unknown Function
Keywords: alpha-beta structure, structural genomics of NIAID, Structural Genomics of National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, Structural Genomics, Unknown Function
Deposited on 2008-08-29, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General stress protein 26
  Species: Bacillus anthracis [TaxId:1392]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q81Z55 (1-138)
  Domains in SCOPe 2.08: d3ec6a_
• Heterogens: FAD, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3ec6A (A:)
  gmhlkekittiiqgqrtgvlstvrndkphsafmmffhedfvlyvatdrqskkitdiennp
  nvhvllgregkkldedyieveglasieedstlknkfwnnslkrwllrpedpnyvlikinp
  dtiyyidgagttepeflrl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ec6A (A:)
  mhlkekittiiqgqrtgvlstvrndkphsafmmffhedfvlyvatdrqskkitdiennpn
  vhvllgrkldedyieveglasieedstlknkfwnnslkrwllrpedpnyvlikinpdtiy
  yidpeflrl