PDB entry 3eb7

View 3eb7 on RCSB PDB site
Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution
Class: toxin
Keywords: Endotoxin, Cry8E, Bacillus Thuringiensis, TOXIN
Deposited on 2008-08-27, released 2008-09-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.169
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insecticidal Delta-Endotoxin Cry8Ea1
    Species: Bacillus Thuringiensis [TaxId:1428]
    Gene: cry8Ea1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EB7 (0-588)
    Domains in SCOPe 2.04: d3eb7a1, d3eb7a2, d3eb7a3
  • Chain 'B':
    Compound: Insecticidal Delta-Endotoxin Cry8Ea1
    Species: Bacillus Thuringiensis [TaxId:1428]
    Gene: cry8Ea1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EB7 (0-588)
    Domains in SCOPe 2.04: d3eb7b1, d3eb7b2, d3eb7b3
  • Chain 'C':
    Compound: Insecticidal Delta-Endotoxin Cry8Ea1
    Species: Bacillus Thuringiensis [TaxId:1428]
    Gene: cry8Ea1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EB7 (0-588)
    Domains in SCOPe 2.04: d3eb7c1, d3eb7c2, d3eb7c3
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eb7A (A:)
    iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
    qkiaeyarakalaeleglgnnyqlyltaleewqenpsstrvlrdvrnrfeildslftqym
    psfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysd
    hcvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmrtypmetkaqltr
    evytdpigaigaqgswydsapsfntlestfirgkhlfdfitrlsiytgrssfsasnylkk
    wighqissqpiggsiqtqtygttsgssviatqqigftgfdvyktlstagvlfaytskyyg
    vskvvfdaiypdnkykttftynpgsegigaqekdsevelppetldqpnyeayshrlnyvt
    firnpdvpvfswthrsadrtntvysdkitqipvvkasdgpkpsanevghylggdpisfns
    sgstgvirlninsplsqkyrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslk
    yenfkfasfstpftfnqaqdtlkisvrnfssivggsvvyidrielipvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eb7B (B:)
    iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
    qkiaeyarakalaeleglgnnyqlyltaleewqenpsstrvlrdvrnrfeildslftqym
    psfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysd
    hcvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmrtypmetkaqltr
    evytdpigaigaqgswydsapsfntlestfirgkhlfdfitrlsiytgrssfsasnylkk
    wighqissqpiggsiqtqtygttsgssviatqqigftgfdvyktlstagvlfaytskyyg
    vskvvfdaiypdnkykttftynpgsegigaqekdsevelppetldqpnyeayshrlnyvt
    firnpdvpvfswthrsadrtntvysdkitqipvvkasdgpkpsanevghylggdpisfns
    sgstgvirlninsplsqkyrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslk
    yenfkfasfstpftfnqaqdtlkisvrnfssivggsvvyidrielipvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3eb7C (C:)
    iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
    qkiaeyarakalaeleglgnnyqlyltaleewqenpsstrvlrdvrnrfeildslftqym
    psfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysd
    hcvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmrtypmetkaqltr
    evytdpigaigaqgswydsapsfntlestfirgkhlfdfitrlsiytgrssfsasnylkk
    wighqissqpiggsiqtqtygttsgssviatqqigftgfdvyktlstagvlfaytskyyg
    vskvvfdaiypdnkykttftynpgsegigaqekdsevelppetldqpnyeayshrlnyvt
    firnpdvpvfswthrsadrtntvysdkitqipvvkasdgpkpsanevghylggdpisfns
    sgstgvirlninsplsqkyrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslk
    yenfkfasfstpftfnqaqdtlkisvrnfssivggsvvyidrielipvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eb7C (C:)
    iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
    qkiaeyarakalaeleglgnnyqlyltaleewqenpstrvlrdvrnrfeildslftqymp
    sfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysdh
    cvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmrtypmetkaqltre
    vytdpigaigaqgswydsapsfntlestfirgkhlfdfitrlsiytgrssfsasnylkkw
    ighqissqpiggsiqtqtygttsgssviatqqigftgfdvyktlstagvlfaytskyygv
    skvvfdaiypdnkykttftynpgsegigaqekdsevelppetldqpnyeayshrlnyvtf
    irnpdvpvfswthrsadrtntvysdkitqipvvkasdgpkpsanevghylggdpisfnss
    gstgvirlninsplsqkyrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslky
    enfkfasfstpftfnqaqdtlkisvrnfssivggsvvyidrielipvn