PDB entry 3eb6

View 3eb6 on RCSB PDB site
Description: Structure of the cIAP2 RING domain bound to UbcH5b
Class: apoptosis, ligase
Keywords: RING domain, E2, Apoptosis, Metal-binding, Zinc-finger, Ligase, Ubl conjugation pathway
Deposited on 2008-08-27, released 2008-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.283
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC3, API2, IAP1, MIHC, RNF49
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Xenopus laevis [TaxId:8355]
    Gene: ube2d2, ubc4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62840 (2-148)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d3eb6b1, d3eb6b2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eb6B (B:)
    gsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfpt
    dypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddp
    lvpeiariyktdrekynriarewtqkyam