PDB entry 3eak

View 3eak on RCSB PDB site
Description: NbBCII10 humanized (FGLA mutant)
Class: immune system
Keywords: antibody, nanobody, humanization, VHH domain, IMMUNE SYSTEM
Deposited on 2008-08-26, released 2008-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-02, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NbBCII10-FGLA
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EAK (0-End)
    Domains in SCOPe 2.07: d3eaka_
  • Chain 'B':
    Compound: NbBCII10-FGLA
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EAK (0-End)
    Domains in SCOPe 2.07: d3eakb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eakA (A:)
    qvqlvesggglvqpggslrlscaasggseysystfslgwfrqapgqgleavaaiasmggl
    tyyadsvkgrftisrdnskntlylqmnslraedtavyycaavrgyfmrlpsshnfrywgq
    gtlvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eakA (A:)
    qvqlvesggglvqpggslrlscaasggseysystfslgwfrqapgqgleavaaiasmggl
    tyyadsvkgrftisrdnskntlylqmnslraedtavyycaavrgyfmrlpsshnfrywgq
    gtlvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eakB (B:)
    qvqlvesggglvqpggslrlscaasggseysystfslgwfrqapgqgleavaaiasmggl
    tyyadsvkgrftisrdnskntlylqmnslraedtavyycaavrgyfmrlpsshnfrywgq
    gtlvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eakB (B:)
    qvqlvesggglvqpggslrlscaasggseysystfslgwfrqapgqgleavaaiasmggl
    tyyadsvkgrftisrdnskntlylqmnslraedtavyycaavrgyfmrlpsshnfrywgq
    gtlvtvs