PDB entry 3eac

View 3eac on RCSB PDB site
Description: Crystal structure of SH2 domain of Human Csk (carboxyl-terminal src kinase), Oxidized form.
Class: transferase
Keywords: SH2, CSK, DISULFIDE, OXIDIZED, Reduced, ATP-binding, Cell membrane, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-08-25, released 2009-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.209
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase CSK
    Species: Homo sapiens [TaxId:9606]
    Gene: CSK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3eaca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eacA (A:)
    agtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscdgkvehyrim
    yhasklsideevyfenlmqlvehytsdadglctrlikpkvmegtva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eacA (A:)
    agtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscdgkvehyrim
    yhasklsideevyfenlmqlvehytsdadglctrlikpkvm