PDB entry 3ea8

View 3ea8 on RCSB PDB site
Description: Crystal structure of SARS-CoV main protease triple mutant STI/A in space group C2
Class: hydrolase
Keywords: SARS coronavirus main protease 3C-like protease mutant extra helical domain, Cytoplasm, Hydrolase, Membrane, Metal-binding, Protease, Ribosomal frameshifting, RNA-binding, Thiol protease, Transmembrane, Zinc, Zinc-finger
Deposited on 2008-08-25, released 2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (0-305)
      • engineered (283-285)
    Domains in SCOPe 2.08: d3ea8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ea8A (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvrqc
    sgvtfq