PDB entry 3e9r

View 3e9r on RCSB PDB site
Description: Crystal structure of purine nucleoside phosphorylase from Schistosoma mansoni in complex with adenine
Class: transferase
Keywords: Purine Nucleoside Phosphorylase, Glycosyltransferase, Transferase
Deposited on 2008-08-23, released 2009-09-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.164
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3e9ra_
  • Chain 'B':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3e9rb_
  • Chain 'C':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3e9rc_
  • Heterogens: SO4, ACT, DMS, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e9rA (A:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9rA (A:)
    esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
    vvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggl
    nrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaee
    ngfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavsl
    vtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e9rB (B:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9rB (B:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtss
    gnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrslk
    lgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfgn
    lvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtnis
    vldveeevlatgaqraelmqswfekiieklpkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e9rC (C:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9rC (C:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsv
    vghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggln
    rslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeen
    gfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslv
    tnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd