PDB entry 3e9o

View 3e9o on RCSB PDB site
Description: Crystal Structure of Yeast Prp8, Residues 1836-2092
Class: RNA binding protein, splicing
Keywords: nucleotidyl transfer, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, RNA BINDING PROTEIN, SPLICING
Deposited on 2008-08-22, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2, YHR165C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33334 (6-257)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d3e9oa1, d3e9oa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e9oA (A:)
    gamgamnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghl
    flkiihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhml
    dfpniairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrlt
    lllralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynv
    nisaltqteikdiilgqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9oA (A:)
    gamnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
    altqteikdiilgqn