PDB entry 3e6y

View 3e6y on RCSB PDB site
Description: Structure of 14-3-3 in complex with the differentiation-inducing agent Cotylenin A
Class: signaling protein
Keywords: adapter protein, signaling protein
Deposited on 2008-08-17, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3-like protein c
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 14-3-3-like protein c
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e6yb_
  • Chain 'C':
    Compound: H+-ATPase phosphopeptide QSYpTV
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E6Y (0-4)
  • Chain 'D':
    Compound: H+-ATPase phosphopeptide QSYpTV
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E6Y (0-4)
  • Heterogens: CW1, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e6yB (B:)
    mavaptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvig
    arraswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaas
    gdskvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlgla
    lnfsvfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd
    mqddgadeikedpkpdeakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6yB (B:)
    aptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarr
    aswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgds
    kvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnf
    svfyyeilnspdracnlakqafdeaiaeeesykdstlimqllrdnltlwtsd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.