PDB entry 3e6m

View 3e6m on RCSB PDB site
Description: The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS.
Class: transcription regulator
Keywords: APC88769, MarR, Silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, DNA-binding, Plasmid, Transcription, Transcription regulation, transcription regulator
Deposited on 2008-08-15, released 2008-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6ma_
  • Chain 'B':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6mb_
  • Chain 'C':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6mc_
  • Chain 'D':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6md_
  • Chain 'E':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6me_
  • Chain 'F':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6mf_
  • Chain 'G':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6mg_
  • Chain 'H':
    Compound: MarR family Transcriptional regulator
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPOA0451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e6mh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e6mA (A:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mA (A:)
    pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
    gqlatlgvmeqsttsrtvdqlvdeglaarsidqrkrtvvltrkgkkklaeisplindfha
    elvgnvdpdklqtcievlgeilkgkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e6mB (B:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mB (B:)
    psfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltvgq
    latlgvmeqsttsrtvdqlvdeglaarsisdqrkrtvvltrkgkkklaeisplindfhae
    lvgnvdpdklqtcievlgeilkgktdy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e6mC (C:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mC (C:)
    pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
    gqlatlgvmeqsttsrtvdqlvdeglaarsisdrkrtvvltrkgkkklaeisplindfha
    elvgnvdpdklqtcievlgeilkgkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e6mD (D:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mD (D:)
    psfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltvgq
    latlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplindfh
    aelvgnvdpdklqtcievlgeilkgktdy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e6mE (E:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mE (E:)
    pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
    gqlatlgvmeqsttsrtvdqlvdeglaarsisrkrtvvltrkgkkklaeisplindfhae
    lvgnvdpdklqtcievlgeilkgktdy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e6mF (F:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mF (F:)
    psfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltvgq
    latlgvmeqsttsrtvdqlvdeglaarsisqrkrtvvltrkgkkklaeisplindfhael
    vgnvdpdklqtcievlgeilkgktdy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3e6mG (G:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mG (G:)
    pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
    gqlatlgvmeqsttsrtvdqlvdeglaarsisqrkrtvvltrkgkkklaeisplindfha
    elvgnvdpdklqtcievlgeilkgktdy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3e6mH (H:)
    snamtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrlls
    slsaygeltvgqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkk
    laeisplindfhaelvgnvdpdklqtcievlgeilkgktdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6mH (H:)
    psfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltvgq
    latlgvmeqsttsrtvdqlvdeglaarsisdqrkrtvvltrkgkkklaeisplindfhae
    lvgnvdpdklqtcievlgeilkgktdy