PDB entry 3e62

View 3e62 on RCSB PDB site
Description: Fragment based discovery of JAK-2 inhibitors
Class: transferase
Keywords: DRUG DISCOVERY, JAK2, FRAGMENT BASED, ATP-binding, Disease mutation, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-08-14, released 2008-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase JAK2
  Species: Homo sapiens [TaxId:9606]
  Gene: JAK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60674 (0-292)
  Domains in SCOPe 2.08: d3e62a_
• Heterogens: 5B1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3e62A (A:)
  rdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfere
  ieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqyts
  qickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespi
  fwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhl
  iellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnma