PDB entry 3e5n

View 3e5n on RCSB PDB site
Description: Crystal strucutre of D-alanine-D-alanine ligase from Xanthomonas oryzae pv. oryzae KACC10331
Class: ligase
Keywords: Bacterial blight, D-alanine-D-alanine ligase, PIP (Plant-Inducible Promoter) box peptidoglycan biosynthesis Xanthomonas oryzae pv. oryzae, ATP-binding, Cell shape, Cell wall biogenesis/degradation, Cytoplasm, Ligase, Magnesium, Manganese, Metal-binding, Nucleotide-binding, Peptidoglycan synthesis
Deposited on 2008-08-14, released 2009-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanine-D-alanine ligase A
    Species: Xanthomonas oryzae pv. oryzae [TaxId:342109]
    Gene: XOO0324
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2P8P8
      • conflict (345)
    Domains in SCOPe 2.06: d3e5na1, d3e5na2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e5nA (A:)
    mghhhhhhhssenlyfqghmrkirvglifggksaehevslqsarnildaldpqrfepvli
    gidkqgqwhvndpdsfllhaddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidv
    vfpivhgtlgedgslqgllrmanlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcf
    drhtaahadvdtliaqlglplfvkpanqgssvgvsqvrtadafaaalalalaydhkvlve
    aavagreiecavlgnavphasvcgevvvhdafysyatkyisehgaeivipadidaqtqqr
    iqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasgldyrg
    litrlielalerhtddqllrsavelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5nA (A:)
    rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
    ddparialhrsgrgvallpgaqqqqlrpiqqalaqidvvfpivhgtlgedgslqgllrma
    nlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplf
    vkpanqgssvgvsqvrtadafaaalalalaydhkvlveaavagreiecavlgnavphasv
    cgevvveivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlp
    gftrisvypklwqasgldyrglitrlielalerhtddqll