PDB entry 3e5a

View 3e5a on RCSB PDB site
Description: Crystal structure of Aurora A in complex with VX-680 and TPX2
Class: transferase
Keywords: AURORA A, SERINE/THREONINE-PROTEIN KINASE, COFACTOR, TPX2, VX-680, INHIBITOR, PHOSPHORYLATION, ATP-binding, Cell cycle, Nucleotide-binding, Phosphoprotein, Transferase, Nucleus
Deposited on 2008-08-13, released 2008-10-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e5aa_
  • Chain 'B':
    Compound: Targeting protein for Xklp2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPX2, C20orf1, C20orf2, DIL2, HCA519
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VX6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e5aA (A:)
    gkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5aA (A:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitanssk
    

  • Chain 'B':
    No sequence available.