PDB entry 3e4d

View 3e4d on RCSB PDB site
Description: Structural and Kinetic Study of an S-Formylglutathione Hydrolase from Agrobacterium tumefaciens
Class: hydrolase
Keywords: S-Formylglutathione Hydrolase, Hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism
Deposited on 2008-08-11, released 2009-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase D
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_2723, Atu1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9CJ11 (1-277)
      • expression tag (0)
    Domains in SCOPe 2.06: d3e4da1, d3e4da2
  • Chain 'B':
    Compound: Esterase D
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_2723, Atu1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9CJ11 (1-277)
      • expression tag (0)
    Domains in SCOPe 2.06: d3e4db1, d3e4db2
  • Chain 'C':
    Compound: Esterase D
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_2723, Atu1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9CJ11 (1-277)
      • expression tag (0)
    Domains in SCOPe 2.06: d3e4dc1, d3e4dc2
  • Chain 'D':
    Compound: Esterase D
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_2723, Atu1476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e4dd_
  • Chain 'E':
    Compound: Esterase D
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_2723, Atu1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9CJ11 (1-277)
      • expression tag (0)
    Domains in SCOPe 2.06: d3e4de1, d3e4de2
  • Chain 'F':
    Compound: Esterase D
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_2723, Atu1476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e4df_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e4dA (A:)
    gmniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanv
    mekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmy
    syvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssa
    dwsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeai
    kgtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e4dB (B:)
    gmniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanv
    mekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmy
    syvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssa
    dwsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeai
    kgtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e4dC (C:)
    gmniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanv
    mekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmy
    syvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssa
    dwsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeai
    kgtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e4dD (D:)
    gmniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanv
    mekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmy
    syvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssa
    dwsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeai
    kgtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e4dD (D:)
    mniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanvm
    ekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmys
    yvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssad
    wsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeaik
    gtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e4dE (E:)
    gmniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanv
    mekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmy
    syvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssa
    dwsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeai
    kgtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e4dF (F:)
    gmniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanv
    mekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmy
    syvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssa
    dwsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeai
    kgtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e4dF (F:)
    mniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanvm
    ekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmys
    yvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssad
    wsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeaik
    gtdigltlrmhdrydhsyyfistfmddhlkwhaerlg