PDB entry 3e46

View 3e46 on RCSB PDB site
Description: Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington interacting protein 2) M172A mutant
Class: ligase
Keywords: Ubiquitin-Conjugating, Huntington Interacting, E2-25K, Ligase, Alternative splicing, Cytoplasm, Ubl conjugation, Ubl conjugation pathway
Deposited on 2008-08-09, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2-25 kDa
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2K, HIP2, LIG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61086 (53-252)
      • expression tag (51-52)
      • engineered (224)
    Domains in SCOPe 2.07: d3e46a1, d3e46a2, d3e46a3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e46A (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamadigsefdmaniavq
    rikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleikipetyp
    fnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaaepddpqd
    avvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcaagfdrnavivalssks
    wdvetatelllsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e46A (A:)
    fdmaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryql
    eikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqalla
    aaepddpqdavvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcaagfdrna
    vivalsskswdvetatelllsn