PDB entry 3e3q

View 3e3q on RCSB PDB site
Description: Structure of the 3alpham13 high-affinity mutant of the 2C TCR in complex with Ld/QL9
Class: immune system
Keywords: TCR, MHC, high affinity, cross reactivity, Glycoprotein, Immune response, Membrane, MHC I, Phosphoprotein, Transmembrane, Immunoglobulin domain, Receptor, IMMUNE SYSTEM
Deposited on 2008-08-07, released 2008-11-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.25
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'B':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'C':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
    Domains in SCOPe 2.04: d3e3qc_
  • Chain 'D':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
  • Chain 'E':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
    Domains in SCOPe 2.04: d3e3qe_
  • Chain 'F':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
    Domains in SCOPe 2.04: d3e3qf_
  • Chain 'G':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)
  • Chain 'H':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'I':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
  • Chain 'J':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
    Domains in SCOPe 2.04: d3e3qj_
  • Chain 'K':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)
  • Chain 'L':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'M':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
  • Chain 'N':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
    Domains in SCOPe 2.04: d3e3qn_
  • Chain 'O':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)
  • Chain 'P':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'Q':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)
  • Chain 'R':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
  • Chain 'S':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
    Domains in SCOPe 2.04: d3e3qs_
  • Chain 'T':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)
  • Chain 'U':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'V':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
  • Chain 'W':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
    Domains in SCOPe 2.04: d3e3qw_
  • Chain 'X':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)
  • Chain 'Y':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'Z':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
  • Chain 'a':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
    Domains in SCOPe 2.04: d3e3qa_
  • Chain 'b':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)
  • Chain 'c':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered (7)
      • engineered (11)
      • engineered (14)
      • engineered (22)
      • engineered (29)
      • engineered (48)
      • engineered (65)
      • engineered (96)
      • engineered (130)
  • Chain 'd':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered (41)
      • engineered (80)
      • engineered (92-96)
  • Chain 'e':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-110)
  • Chain 'f':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E3Q (0-8)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qC (C:)
    svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvng
    feaefsksnssfhlrkasvhrsdsavyfcavsdppplltfgsgtkvivl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qE (E:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qF (F:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qJ (J:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qN (N:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qS (S:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qW (W:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3qa (a:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.