PDB entry 3e3e

View 3e3e on RCSB PDB site
Description: Human Thioredoxin Double Mutant C35S,C73R
Class: electron transport
Keywords: Electron Transport, Phosphoprotein, Redox-active center
Deposited on 2008-08-07, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered (34)
      • engineered (72)
    Domains in SCOPe 2.07: d3e3ea_
  • Chain 'B':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered (34)
      • engineered (72)
    Domains in SCOPe 2.07: d3e3eb_
  • Heterogens: P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3eA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpskmikpffhslsekysnviflevdvd
    dcqdvasecevkrmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e3eB (B:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpskmikpffhslsekysnviflevdvd
    dcqdvasecevkrmptfqffkkgqkvgefsgankekleatinelv