PDB entry 3e3a

View 3e3a on RCSB PDB site
Description: The Structure of Rv0554 from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: alpha/beta hydrolase, Oxidoreductase, Peroxidase
Deposited on 2008-08-06, released 2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: possible peroxidase bpoc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bpoC, MT0580, Rv0554
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06420 (25-292)
      • expression tag (19-24)
      • expression tag (26-31)
    Domains in SCOPe 2.06: d3e3aa1, d3e3aa2
  • Chain 'B':
    Compound: possible peroxidase bpoc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bpoC, MT0580, Rv0554
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06420 (25-End)
      • expression tag (17-24)
      • expression tag (26-31)
    Domains in SCOPe 2.06: d3e3ab1, d3e3ab2
  • Heterogens: ACT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e3aA (A:)
    msyyhhhhhhdydipttenlyfqgamdpefrvinlayddngtgdpvvfiagrggagrtwh
    phqvpaflaagyrcitfdnrgigatenaegfttqtmvadtaalietldiaparvvgvsmg
    afiaqelmvvapelvssavlmatrgrldrarqffnkaeaelydsgvqlpptydararlle
    nfsrktlnddvavgdwiamfsmwpikstpglrcqldcapqtnrlpayrniaapvlvigfa
    ddvvtppylgrevadalpngrylqipdaghlgfferpeavntamlkffasvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3aA (A:)
    lyfqgamdpefrvinlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdn
    rgigatenaegfttqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssav
    lmatrgrldrarqffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiam
    fsmwpikstpglrcqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpn
    grylqipdaghlgfferpeavntamlkffasvka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e3aB (B:)
    msyyhhhhhhdydipttenlyfqgamdpefrvinlayddngtgdpvvfiagrggagrtwh
    phqvpaflaagyrcitfdnrgigatenaegfttqtmvadtaalietldiaparvvgvsmg
    afiaqelmvvapelvssavlmatrgrldrarqffnkaeaelydsgvqlpptydararlle
    nfsrktlnddvavgdwiamfsmwpikstpglrcqldcapqtnrlpayrniaapvlvigfa
    ddvvtppylgrevadalpngrylqipdaghlgfferpeavntamlkffasvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3aB (B:)
    enlyfqgamdpefrvinlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitf
    dnrgigatenaegfttqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvss
    avlmatrgrldrarqffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwi
    amfsmwpikstpglrcqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadal
    pngrylqipdaghlgfferpeavntamlkffasvk