PDB entry 3e2m

View 3e2m on RCSB PDB site
Description: LFA-1 I domain bound to inhibitors
Class: cell adhesion
Keywords: integrin I-domain, leukocyte function associated antigen-1, alternative splicing, calcium, cell adhesion, glycoprotein, magnesium, membrane, polymorphism, receptor, transmembrane
Deposited on 2008-08-05, released 2008-08-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: HOMO SAPIENS
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (Start-184)
      • variant (64)
    Domains in SCOPe 2.03: d3e2ma_
  • Chain 'B':
    Compound: Integrin alpha-L
    Species: HOMO SAPIENS
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (Start-184)
      • variant (64)
    Domains in SCOPe 2.03: d3e2mb_
  • Heterogens: E2M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e2mA (A:)
    gskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiyvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2mA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e2mB (B:)
    gskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiyvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2mB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi