PDB entry 3e1o

View 3e1o on RCSB PDB site
Description: Crystal structure of E. coli Bacterioferritin (BFR) with two ZN(II) ION sites at the Ferroxidase centre (ZN-BFR).
Class: metal binding protein
Keywords: bacterioferritin. rhombic dodecahedral superstructure., heme, iron, iron storage, metal-binding, metal binding protein
Deposited on 2008-08-04, released 2009-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1oa_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1ob_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1oc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1od_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1oe_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1of_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1og_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1oh_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1oi_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1oj_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1ok_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1ol_
  • Heterogens: SO4, ZN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e1oA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e1oB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e1oC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e1oD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e1oE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e1oF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3e1oG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3e1oH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3e1oI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3e1oJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3e1oK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3e1oL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1oL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire