PDB entry 3e1n

View 3e1n on RCSB PDB site
Description: Crystal structure of E. coli Bacterioferritin (BFR) after a 65 minute (aerobic) exposure to FE(II) revealing a possible MU-OXO bridge/MU-Hydroxy bridged DIIRON intermediate at the ferroxidase centre. (FE(III)-O-FE(III)-BFR).
Class: metal binding protein
Keywords: bacterioferritin. rhombic dodecahedral superstructure., heme, iron, iron storage, metal-binding, metal binding protein
Deposited on 2008-08-04, released 2009-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.251
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1na_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1ne_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nf_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1ng_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nh_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1ni_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nj_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nk_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e1nl_
  • Heterogens: SO4, FE2, UNK, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e1nA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e1nB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e1nC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e1nD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e1nE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e1nF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3e1nG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3e1nH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3e1nI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3e1nJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3e1nK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3e1nL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1nL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire