PDB entry 3e1l

View 3e1l on RCSB PDB site
Description: Crystal structure of E. coli Bacterioferritin (BFR) soaked in phosphate with an alternative conformation of the unoccupied Ferroxidase centre (APO-BFR II).
Class: metal binding protein
Keywords: bacterioferritin. rhombic dodecahedral superstructure, heme, iron, iron storage, metal-binding, metal binding protein
Deposited on 2008-08-04, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1la_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1lb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1lc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1ld_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1le_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1lf_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1lg_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1lh_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1li_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1lj_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1lk_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: BFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1ll_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1lL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg