PDB entry 3e1k

View 3e1k on RCSB PDB site
Description: Crystal structure of Kluyveromyces lactis Gal80p in complex with the acidic activation domain of Gal4p
Class: transcription
Keywords: transctiption, repressor, trans-activation, Carbohydrate metabolism, DNA-binding, Galactose metabolism, Transcription, Transcription regulation, Activator, Metal-binding, Nucleus, Zinc
Deposited on 2008-08-04, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06433 (Start-456)
      • expression tag (457-458)
    Domains in SCOPe 2.07: d3e1ka1, d3e1ka2, d3e1ka3
  • Chain 'B':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1kc1, d3e1kc2
  • Chain 'D':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1ke1, d3e1ke2
  • Chain 'F':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1kg1, d3e1kg2
  • Chain 'H':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1ki1, d3e1ki2
  • Chain 'J':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1kk1, d3e1kk2
  • Chain 'L':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1km1, d3e1km2
  • Chain 'N':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1ko1, d3e1ko2
  • Chain 'P':
    Compound: Lactose regulatory protein LAC9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e1kA (A:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kA (A:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimile
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e1kC (C:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kC (C:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e1kE (E:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kE (E:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3e1kG (G:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kG (G:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3e1kI (I:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kI (I:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3e1kK (K:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kK (K:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3e1kM (M:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kM (M:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3e1kO (O:)
    mnnnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlkss
    lqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlryly
    vewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakelisegcigdinsieis
    gnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnnipt
    qflldengkrtketisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgt
    kgdlkiegdagfveisnlvlyfygikngngssngtdnngaaaikdkekvtkspspstgts
    eeeqtmevfhlrnynsvvgnilriyesiadyhflgkpeskssrgpddlfastkfdkqgfr
    fegfptfkdaiilhrlidavfrsdkeektldvskimilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e1kO (O:)
    ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
    gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
    elysisqqranlqtiiclqgrkspyivrakelisegcigdinsieisgnggwygyerpmr
    speylydiesgvnlisnsfghtidvlqyitgsyfqkinamisnniptqflldengkrtke
    tisktcpdhllfqgilengkvpvscsfkggtpvkkltknlvidihgtkgdlkiegdagfv
    eisnlvlyfygikngeeqtmevfhlrnynsvvgnilriyesiadyhflkfdkqgfrfegf
    ptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'P':
    No sequence available.