PDB entry 3e11

View 3e11 on RCSB PDB site
Description: Crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 A resolution
Class: unknown function
Keywords: Duf1025 family protein, zincin-like fold, conserved matrix metalloprotease motif, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2008-08-01, released 2008-08-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: predicted zincin-like metalloprotease
    Species: Acidothermus cellulolyticus 11B, synthetic [TaxId:351607]
    Gene: YP_873820.1, Acel_2062
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0LWM4 (1-113)
      • leader sequence (0)
    Domains in SCOPe 2.02: d3e11a1
  • Chain 'B':
    Compound: predicted zincin-like metalloprotease
    Species: Acidothermus cellulolyticus 11B, synthetic [TaxId:351607]
    Gene: YP_873820.1, Acel_2062
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0LWM4 (1-113)
      • leader sequence (0)
    Domains in SCOPe 2.02: d3e11b_
  • Heterogens: ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3e11A (A:)
gmvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgipltertta
yggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3e11B (B:)
gmvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgipltertta
yggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy